General Information

  • ID:  hor005513
  • Uniprot ID:  Q10987
  • Protein name:  Molt-inhibiting hormone
  • Gene name:  NA
  • Organism:  Procambarus bouvieri (Mexican crayfish)
  • Family:  arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Procambarus (genus), Cambarinae (subfamily), Cambaridae (family), Astacoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QVFDQACKGIYDRAIFKKLELVCDDCYNLYRKPKVATTCRENCYANSVFRQCLDDLLLINVVDEYISGVQIV
  • Length:  72
  • Propeptide:  QVFDQACKGIYDRAIFKKLELVCDDCYNLYRKPKVATTCRENCYANSVFRQCLDDLLLINVVDEYISGVQIVGK
  • Signal peptide:  NA
  • Modification:  T1 Pyrrolidone carboxylic acid;T72 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits Y-organs where molting hormone (ecdysteroid) is secreted.A molting cycle is initiated when MIH secretion diminishes or stops
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-43; 23-39; 26-52
  • Structure ID:  AF-Q10987-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005513_AF2.pdbhor005513_ESM.pdb

Physical Information

Mass: 961132 Formula: C370H585N97O110S6
Absent amino acids: HMW Common amino acids: VDL
pI: 4.94 Basic residues: 9
Polar residues: 21 Hydrophobic residues: 27
Hydrophobicity: 1.25 Boman Index: -11316
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 102.78
Instability Index: 1514.72 Extinction Coefficient cystines: 7825
Absorbance 280nm: 110.21

Literature

  • PubMed ID:  8735961
  • Title:  Complete primary structure of the molt-inhibiting hormone (MIH) of the Mexican crayfish Procambarus bouvieri (Ortmann).